CCL25 (Human) Recombinant Protein
  • CCL25 (Human) Recombinant Protein

CCL25 (Human) Recombinant Protein

Ref: AB-P7223
CCL25 (Human) Recombinant Protein

Información del producto

Human CCL25 (O15444, 24 a.a. - 150 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL25
Gene Alias Ckb15|MGC150327|SCYA25|TECK
Gene Description chemokine (C-C motif) ligand 25
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 6370

Enviar uma mensagem


CCL25 (Human) Recombinant Protein

CCL25 (Human) Recombinant Protein