CCL17 (Human) Recombinant Protein
  • CCL17 (Human) Recombinant Protein

CCL17 (Human) Recombinant Protein

Ref: AB-P7216
CCL17 (Human) Recombinant Protein

Información del producto

Human CCL17 (Q92583, 24 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL17
Gene Alias A-152E5.3|ABCD-2|MGC138271|MGC138273|SCYA17|TARC
Gene Description chemokine (C-C motif) ligand 17
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 6361

Enviar uma mensagem


CCL17 (Human) Recombinant Protein

CCL17 (Human) Recombinant Protein