CXCL9 (Human) Recombinant Protein
  • CXCL9 (Human) Recombinant Protein

CXCL9 (Human) Recombinant Protein

Ref: AB-P7202
CXCL9 (Human) Recombinant Protein

Información del producto

Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CXCL9
Gene Alias CMK|Humig|MIG|SCYB9|crg-10
Gene Description chemokine (C-X-C motif) ligand 9
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 4283

Enviar uma mensagem


CXCL9 (Human) Recombinant Protein

CXCL9 (Human) Recombinant Protein