CXCL3 (Human) Recombinant Protein
  • CXCL3 (Human) Recombinant Protein

CXCL3 (Human) Recombinant Protein

Ref: AB-P7199
CXCL3 (Human) Recombinant Protein

Información del producto

Human CXCL3 (P19876, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name CXCL3
Gene Alias CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3
Gene Description chemokine (C-X-C motif) ligand 3
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 2921

Enviar uma mensagem


CXCL3 (Human) Recombinant Protein

CXCL3 (Human) Recombinant Protein