MICB (Human) Recombinant Protein
  • MICB (Human) Recombinant Protein

MICB (Human) Recombinant Protein

Ref: AB-P7192
MICB (Human) Recombinant Protein

Información del producto

Human MICB (Q29980, 23 a.a. - 254 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name MICB
Gene Alias PERB11.2
Gene Description MHC class I polypeptide-related sequence B
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY_x005F_x000D__x000D_181RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR_x005F_x000D__
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 4277

Enviar uma mensagem


MICB (Human) Recombinant Protein

MICB (Human) Recombinant Protein