Tnf (Mouse) Recombinant Protein
  • Tnf (Mouse) Recombinant Protein

Tnf (Mouse) Recombinant Protein

Ref: AB-P7183
Tnf (Mouse) Recombinant Protein

Información del producto

Mouse Tnf (P06804, 80 a.a. - 235 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Tnf
Gene Alias DIF|MGC151434|TNF-alpha|TNFSF2|TNFalpha|Tnfa|Tnfsf1a
Gene Description tumor necrosis factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 21926

Enviar uma mensagem


Tnf (Mouse) Recombinant Protein

Tnf (Mouse) Recombinant Protein