Il33 (Mouse) Recombinant Protein
  • Il33 (Mouse) Recombinant Protein

Il33 (Mouse) Recombinant Protein

Ref: AB-P7182
Il33 (Mouse) Recombinant Protein

Información del producto

Mouse Il33 (Q8BVZ5, 109 a.a. - 266 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il33
Gene Alias 9230117N10Rik|Il-33|Il1f11|NF-HEV
Gene Description interleukin 33
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 77125

Enviar uma mensagem


Il33 (Mouse) Recombinant Protein

Il33 (Mouse) Recombinant Protein