IFNL1 (Human) Recombinant Protein
  • IFNL1 (Human) Recombinant Protein

IFNL1 (Human) Recombinant Protein

Ref: AB-P7166
IFNL1 (Human) Recombinant Protein

Información del producto

Human IFNL1 (Q8IU54, 20 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IL29
Gene Alias IFNL1|IL-29
Gene Description interleukin 29 (interferon, lambda 1)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 282618

Enviar uma mensagem


IFNL1 (Human) Recombinant Protein

IFNL1 (Human) Recombinant Protein