TNFRSF17 (Human) Recombinant Protein
  • TNFRSF17 (Human) Recombinant Protein

TNFRSF17 (Human) Recombinant Protein

Ref: AB-P7164
TNFRSF17 (Human) Recombinant Protein

Información del producto

Human TNFRSF17 (Q02223, 5 a.a. - 54 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name TNFRSF17
Gene Alias BCM|BCMA|CD269
Gene Description tumor necrosis factor receptor superfamily, member 17
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 608

Enviar uma mensagem


TNFRSF17 (Human) Recombinant Protein

TNFRSF17 (Human) Recombinant Protein