PLG (Human) Recombinant Protein
  • PLG (Human) Recombinant Protein

PLG (Human) Recombinant Protein

Ref: AB-P7163
PLG (Human) Recombinant Protein

Información del producto

Human PLG (P00747, 98 a.a. - 356 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name PLG
Gene Alias DKFZp779M0222
Gene Description plasminogen
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSC
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 5340

Enviar uma mensagem


PLG (Human) Recombinant Protein

PLG (Human) Recombinant Protein