SERPINF1 (Human) Recombinant Protein
  • SERPINF1 (Human) Recombinant Protein

SERPINF1 (Human) Recombinant Protein

Ref: AB-P7160
SERPINF1 (Human) Recombinant Protein

Información del producto

Human SERPINF1 (P36955, 20 a.a. - 418 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name SERPINF1
Gene Alias EPC-1|PEDF|PIG35
Gene Description serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSI
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 5176

Enviar uma mensagem


SERPINF1 (Human) Recombinant Protein

SERPINF1 (Human) Recombinant Protein