IL7 (Human) Recombinant Protein
  • IL7 (Human) Recombinant Protein

IL7 (Human) Recombinant Protein

Ref: AB-P7153
IL7 (Human) Recombinant Protein

Información del producto

Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL7
Gene Alias IL-7
Gene Description interleukin 7
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 3574

Enviar uma mensagem


IL7 (Human) Recombinant Protein

IL7 (Human) Recombinant Protein