View larger
Human LIF (P15018, 23 a.a. - 202 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7142
New product
LIF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | LIF |
| Gene Alias | CDF|DIA|HILDA |
| Gene Description | leukemia inhibitory factor (cholinergic differentiation factor) |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
| Form | Lyophilized |
| Quality control testing | 2 ug protein in Reducing and Non-Reducing SDS PAGE Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 3976 |
More info
Human LIF (P15018, 23 a.a. - 202 a.a.) partial recombinant protein expressed in Escherichia coli.