H3C1 (Human) Recombinant Protein
  • H3C1 (Human) Recombinant Protein

H3C1 (Human) Recombinant Protein

Ref: AB-P7139
H3C1 (Human) Recombinant Protein

Información del producto

Human H3C1 (P68431, 1 a.a. - 136 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name HIST1H3A
Gene Alias H3/A|H3FA
Gene Description histone cluster 1, H3a
Storage Conditions Store at -20C to -80C for 24 month. Once rehydrated, aliquot and store at -20°C.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Form Lyophilized
Storage Buffer Lyophilized from PBS
Gene ID 8350

Enviar uma mensagem


H3C1 (Human) Recombinant Protein

H3C1 (Human) Recombinant Protein