IL16 (Human) Recombinant Protein
  • IL16 (Human) Recombinant Protein

IL16 (Human) Recombinant Protein

Ref: AB-P7138
IL16 (Human) Recombinant Protein

Información del producto

Human IL16 (Q14005, 1 a.a. - 130 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL16
Gene Alias FLJ16806|FLJ42735|FLJ44234|HsT19289|IL-16|LCF|prIL-16
Gene Description interleukin 16 (lymphocyte chemoattractant factor)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 3603

Enviar uma mensagem


IL16 (Human) Recombinant Protein

IL16 (Human) Recombinant Protein