IL22 (Human) Recombinant Protein
  • IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein

Ref: AB-P7124
IL22 (Human) Recombinant Protein

Información del producto

Human IL-22 (Q9GZX6, 34 a.a. - 179 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name IL22
Gene Alias IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18
Gene Description interleukin 22
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 50616

Enviar uma mensagem


IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein