CSF3 (Human) Recombinant Protein
  • CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein

Ref: AB-P7107
CSF3 (Human) Recombinant Protein

Información del producto

Human CSF3 (Q8N4W3, 27 a.a. - 200 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name CSF3
Gene Alias G-CSF|GCSF|MGC45931
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRH
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 1440

Enviar uma mensagem


CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein