Il5 (Rat) Recombinant Protein
  • Il5 (Rat) Recombinant Protein

Il5 (Rat) Recombinant Protein

Ref: AB-P7099
Il5 (Rat) Recombinant Protein

Información del producto

Rat IL5 (Q08125, 20 a.a. - 132 a.a.) partial recombinant protein expressed in CHO cell.
Información adicional
Size 10 ug
Gene Name Il5
Gene Alias -
Gene Description interleukin 5
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 24497

Enviar uma mensagem


Il5 (Rat) Recombinant Protein

Il5 (Rat) Recombinant Protein