S (SARS-CoV) RBD Recombinant Protein
  • S (SARS-CoV) RBD Recombinant Protein

S (SARS-CoV) RBD Recombinant Protein

Ref: AB-P6672
S (SARS-CoV) RBD Recombinant Protein

Información del producto

SARS-CoV S RBD (NP_828851.1, 306 a.a. - 515 a.a.) recombinant protein with His tag at C-terminal expressed in Baculovirus insect cells.
Información adicional
Size 100 ug
Storage Conditions Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLHHHHHH
Form Liquid
Recomended Dilution Bioactivity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species SARS-CoV
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).

Enviar uma mensagem


S (SARS-CoV) RBD Recombinant Protein

S (SARS-CoV) RBD Recombinant Protein