S (Human coronavirus OC43) Recombinant Protein
  • S (Human coronavirus OC43) Recombinant Protein

S (Human coronavirus OC43) Recombinant Protein

Ref: AB-P6611
S (Human coronavirus OC43) Recombinant Protein

Información del producto

Human coronavirus OC43 S (P36334, 15 a.a. - 344 a.a.) partial recombinant protein with N-terminal His tag expressed in Yeast expression system.
Información adicional
Size 500 ug
Storage Conditions Store at -20C or lower, liquid antibodies are stable at least 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPL
Form Liquid
Recomended Dilution SDS-PAGE
Antigen species Target species Viruses
Storage Buffer In Tris-based buffer (50% glycerol).

Enviar uma mensagem


S (Human coronavirus OC43) Recombinant Protein

S (Human coronavirus OC43) Recombinant Protein