View larger
Human FGF7 (P21781) recombinant protein expressed in <i>E.Coli</i>.
AB-P6442
New product
FGF7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | FGF7 |
| Gene Alias | HBGF-7|KGF |
| Gene Description | fibroblast growth factor 7 (keratinocyte growth factor) |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.<br>If a precipitate is observed, centrifuge t |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 100 mM sodium chloride, pH 7.5. |
| Gene ID | 2252 |
More info
Human FGF7 (P21781) recombinant protein expressed in E.Coli.