PDGFB (Human) Recombinant Protein
  • PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein

Ref: AB-P6441
PDGFB (Human) Recombinant Protein

Información del producto

Human PDGFB (P01127) recombinant protein expressed in E.Coli.
Información adicional
Size 10 ug
Gene Name PDGFB
Gene Alias FLJ12858|PDGF2|SIS|SSV|c-sis
Gene Description platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 5155

Enviar uma mensagem


PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein