IGF2 (Human) Recombinant Protein
  • IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein

Ref: AB-P6438
IGF2 (Human) Recombinant Protein

Información del producto

Human IGF2 (P01344) recombinant protein expressed in E.Coli.
Información adicional
Size 10 ug
Gene Name IGF2
Gene Alias C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974
Gene Description insulin-like growth factor 2 (somatomedin A)
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 3481

Enviar uma mensagem


IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein