IGF2 (Human) Recombinant Protein View larger

Human IGF2 (P01344) recombinant protein expressed in <i>E.Coli</i>.

AB-P6438

New product

IGF2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name IGF2
Gene Alias C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974
Gene Description insulin-like growth factor 2 (somatomedin A)
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 3481

More info

Human IGF2 (P01344) recombinant protein expressed in E.Coli.

Enviar uma mensagem

Human IGF2 (P01344) recombinant protein expressed in <i>E.Coli</i>.

Human IGF2 (P01344) recombinant protein expressed in <i>E.Coli</i>.