Tnfsf10 (Mouse) Recombinant Protein View larger

Mouse Tnfsf10 (P50592) recombinant protein expressed in <i>E. Coli</i>.

AB-P6421

New product

Tnfsf10 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name Tnfsf10
Gene Alias A330042I21Rik|AI448571|APO-2L|Ly81|TL2|Trail
Gene Description tumor necrosis factor (ligand) superfamily, member 10
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 22035

More info

Mouse Tnfsf10 (P50592) recombinant protein expressed in E. Coli.

Enviar uma mensagem

Mouse Tnfsf10 (P50592) recombinant protein expressed in <i>E. Coli</i>.

Mouse Tnfsf10 (P50592) recombinant protein expressed in <i>E. Coli</i>.