SPARC (Human) Recombinant Protein
  • SPARC (Human) Recombinant Protein

SPARC (Human) Recombinant Protein

Ref: AB-P6405
SPARC (Human) Recombinant Protein

Información del producto

Human SPARC (P09486) recombinant protein expressed in E. Coli.
Información adicional
Size 50 ug
Gene Name SPARC
Gene Alias ON
Gene Description secreted protein, acidic, cysteine-rich (osteonectin)
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFET
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 6678

Enviar uma mensagem


SPARC (Human) Recombinant Protein

SPARC (Human) Recombinant Protein