Shh (Mouse) Recombinant Protein
  • Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein

Ref: AB-P6403
Shh (Mouse) Recombinant Protein

Información del producto

Mouse Shh (Q62226) recombinant protein expressed in E. Coli.
Información adicional
Size 25 ug
Gene Name Shh
Gene Alias 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081
Gene Description sonic hedgehog
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 20423

Enviar uma mensagem


Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein