Ccl5 (Rat) Recombinant Protein
  • Ccl5 (Rat) Recombinant Protein

Ccl5 (Rat) Recombinant Protein

Ref: AB-P6394
Ccl5 (Rat) Recombinant Protein

Información del producto

Rat Ccl5 (P50231) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name Ccl5
Gene Alias Rantes|Scya5
Gene Description chemokine (C-C motif) ligand 5
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 81780

Enviar uma mensagem


Ccl5 (Rat) Recombinant Protein

Ccl5 (Rat) Recombinant Protein