PlGF2 (Human) Recombinant Protein
  • PlGF2 (Human) Recombinant Protein

PlGF2 (Human) Recombinant Protein

Ref: AB-P6388
PlGF2 (Human) Recombinant Protein

Información del producto

Human PlGF2 (P49763-3) recombinant protein expressed in E. Coli.
Información adicional
Size 25 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 5228

Enviar uma mensagem


PlGF2 (Human) Recombinant Protein

PlGF2 (Human) Recombinant Protein