TNFRSF11B (Human) Recombinant Protein
  • TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein

Ref: AB-P6382
TNFRSF11B (Human) Recombinant Protein

Información del producto

Human TNFRSF11B (O00300) recombinant protein expressed in E. Coli.
Información adicional
Size 100 ug
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 4982

Enviar uma mensagem


TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein