TNFSF14 (Human) Recombinant Protein
  • TNFSF14 (Human) Recombinant Protein

TNFSF14 (Human) Recombinant Protein

Ref: AB-P6372
TNFSF14 (Human) Recombinant Protein

Información del producto

Human TNFSF14 (O43557) recombinant protein expressed in CHO cells.
Información adicional
Size 20 ug
Gene Name TNFSF14
Gene Alias CD258|HVEML|LIGHT|LTg|TR2
Gene Description tumor necrosis factor (ligand) superfamily, member 14
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 8740

Enviar uma mensagem


TNFSF14 (Human) Recombinant Protein

TNFSF14 (Human) Recombinant Protein