TNFSF14 (Human) Recombinant Protein View larger

Human TNFSF14 (O43557) recombinant protein expressed in CHO cells.

AB-P6372

New product

TNFSF14 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name TNFSF14
Gene Alias CD258|HVEML|LIGHT|LTg|TR2
Gene Description tumor necrosis factor (ligand) superfamily, member 14
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 8740

More info

Human TNFSF14 (O43557) recombinant protein expressed in CHO cells.

Enviar uma mensagem

Human TNFSF14 (O43557) recombinant protein expressed in CHO cells.

Human TNFSF14 (O43557) recombinant protein expressed in CHO cells.