Il7 (Rat) Recombinant Protein
  • Il7 (Rat) Recombinant Protein

Il7 (Rat) Recombinant Protein

Ref: AB-P6369
Il7 (Rat) Recombinant Protein

Información del producto

Rat Il7 (P56478) recombinant protein expressed in E. Coli.
Información adicional
Size 10 ug
Gene Name Il7
Gene Alias -
Gene Description interleukin 7
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 25647

Enviar uma mensagem


Il7 (Rat) Recombinant Protein

Il7 (Rat) Recombinant Protein