MDK (Human) Recombinant Protein
  • MDK (Human) Recombinant Protein

MDK (Human) Recombinant Protein

Ref: AB-P6364
MDK (Human) Recombinant Protein

Información del producto

Human MDK (P21741) recombinant protein expressed in E. Coli.
Información adicional
Size 100 ug
Gene Name MDK
Gene Alias FLJ27379|MK|NEGF2
Gene Description midkine (neurite growth-promoting factor 2)
Storage Conditions Stored at -20C on dry atmosphere in lyophilized form.
After reconstitution with distilled water to a concentration not less than 0.1 mg/mL, this product can be stored in working aliquots at 2-8C for one month, or at -20C for six months, with a carrier
Application Key WB,Func
Immunogen Prot. Seq VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 4192

Enviar uma mensagem


MDK (Human) Recombinant Protein

MDK (Human) Recombinant Protein