FGF17 (Human) Recombinant Protein
  • FGF17 (Human) Recombinant Protein

FGF17 (Human) Recombinant Protein

Ref: AB-P6355
FGF17 (Human) Recombinant Protein

Información del producto

Human FGF17 (O60258) recombinant protein expressed in E. Coli.
Información adicional
Size 100 ug
Gene Name FGF17
Gene Alias FGF-13
Gene Description fibroblast growth factor 17
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 8822

Enviar uma mensagem


FGF17 (Human) Recombinant Protein

FGF17 (Human) Recombinant Protein