DLL1 (Human) Recombinant Protein
  • DLL1 (Human) Recombinant Protein

DLL1 (Human) Recombinant Protein

Ref: AB-P6349
DLL1 (Human) Recombinant Protein

Información del producto

Human DLL1 (O00548) recombinant protein expressed in CHO cells.
Información adicional
Size 100 ug
Gene Name DLL1
Gene Alias DELTA1|DL1|Delta
Gene Description delta-like 1 (Drosophila)
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq SGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNC
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 28514

Enviar uma mensagem


DLL1 (Human) Recombinant Protein

DLL1 (Human) Recombinant Protein