DKK3 (Human) Recombinant Protein
  • DKK3 (Human) Recombinant Protein

DKK3 (Human) Recombinant Protein

Ref: AB-P6347
DKK3 (Human) Recombinant Protein

Información del producto

Human DKK3 (Q9UBP4) recombinant protein expressed in CHO cells.
Información adicional
Size 100 ug
Gene Name DKK3
Gene Alias REIC
Gene Description dickkopf homolog 3 (Xenopus laevis)
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPH
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 27122

Enviar uma mensagem


DKK3 (Human) Recombinant Protein

DKK3 (Human) Recombinant Protein