GDF11 (Human/Mouse/Rat) Recombinant Protein
  • GDF11 (Human/Mouse/Rat) Recombinant Protein

GDF11 (Human/Mouse/Rat) Recombinant Protein

Ref: AB-P6319
GDF11 (Human/Mouse/Rat) Recombinant Protein

Información del producto

Human/Mouse/Rat GDF11 (O95390/Q9Z1W4/Q9Z217) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name GDF11
Gene Alias BMP-11|BMP11
Gene Description growth differentiation factor 11
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile 10 mM HCl at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 10220|14561|29454

Enviar uma mensagem


GDF11 (Human/Mouse/Rat) Recombinant Protein

GDF11 (Human/Mouse/Rat) Recombinant Protein