Lep (Rat) Recombinant Protein
  • Lep (Rat) Recombinant Protein

Lep (Rat) Recombinant Protein

Ref: AB-P6297
Lep (Rat) Recombinant Protein

Información del producto

Rat Lep (P50596) recombinant protein expressed in E.Coli.
Información adicional
Size 200 ug
Gene Name Lep
Gene Alias OB|obese
Gene Description leptin
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 25608

Enviar uma mensagem


Lep (Rat) Recombinant Protein

Lep (Rat) Recombinant Protein