Retnlg (Mouse) Recombinant Protein
  • Retnlg (Mouse) Recombinant Protein

Retnlg (Mouse) Recombinant Protein

Ref: AB-P6287
Retnlg (Mouse) Recombinant Protein

Información del producto

Mouse Retnlg (Q8K426) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Retnlg
Gene Alias Fizz3|Relmg|Xcp1
Gene Description resistin like gamma
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 245195

Enviar uma mensagem


Retnlg (Mouse) Recombinant Protein

Retnlg (Mouse) Recombinant Protein