Mif (Mouse) Recombinant Protein
  • Mif (Mouse) Recombinant Protein

Mif (Mouse) Recombinant Protein

Ref: AB-P6279
Mif (Mouse) Recombinant Protein

Información del producto

Mouse Mif (P34884) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Mif
Gene Alias GIF|Glif|MGC107654
Gene Description macrophage migration inhibitory factor
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
The product works best when used fresh after re
Application Key WB
Immunogen Prot. Seq MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 17319

Enviar uma mensagem


Mif (Mouse) Recombinant Protein

Mif (Mouse) Recombinant Protein