Il19 (Mouse) Recombinant Protein
  • Il19 (Mouse) Recombinant Protein

Il19 (Mouse) Recombinant Protein

Ref: AB-P6277
Il19 (Mouse) Recombinant Protein

Información del producto

Mouse Il19 (Q8CJ70) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Il19
Gene Alias -
Gene Description interleukin 19
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5.
Gene ID 329244

Enviar uma mensagem


Il19 (Mouse) Recombinant Protein

Il19 (Mouse) Recombinant Protein