Il27 (Mouse) Recombinant Protein
  • Il27 (Mouse) Recombinant Protein

Il27 (Mouse) Recombinant Protein

Ref: AB-P6274
Il27 (Mouse) Recombinant Protein

Información del producto

Mouse Il27 (Q8K3I6) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Il27
Gene Alias IL-27|IL-27p28|Il30|p28
Gene Description interleukin 27
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium bicarbonate, pH 8.5.
Gene ID 246779

Enviar uma mensagem


Il27 (Mouse) Recombinant Protein

Il27 (Mouse) Recombinant Protein