View larger
Mouse Il27 (Q8K3I6) recombinant protein expressed in <i>E.Coli</i>.
AB-P6274
New product
Il27 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 11 pontos de fidelização. Seu carrinho totalizará 11 pontos de fidelização que podem ser convertidos num vale de desconto de 44.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Il27 |
| Gene Alias | IL-27|IL-27p28|Il30|p28 |
| Gene Description | interleukin 27 |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB |
| Immunogen Prot. Seq | MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium bicarbonate, pH 8.5. |
| Gene ID | 246779 |
More info
Mouse Il27 (Q8K3I6) recombinant protein expressed in E.Coli.