Lif (Mouse) Recombinant Protein
  • Lif (Mouse) Recombinant Protein

Lif (Mouse) Recombinant Protein

Ref: AB-P6270
Lif (Mouse) Recombinant Protein

Información del producto

Mouse Lif (P09056) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Lif
Gene Alias -
Gene Description leukemia inhibitory factor
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile 10 mM acetic acid at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 16878

Enviar uma mensagem


Lif (Mouse) Recombinant Protein

Lif (Mouse) Recombinant Protein