PSPN (Human) Recombinant Protein
  • PSPN (Human) Recombinant Protein

PSPN (Human) Recombinant Protein

Ref: AB-P6263
PSPN (Human) Recombinant Protein

Información del producto

Human PSPN (O60542) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name PSPN
Gene Alias PSP
Gene Description persephin
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 5623

Enviar uma mensagem


PSPN (Human) Recombinant Protein

PSPN (Human) Recombinant Protein