IFNG (Human) Recombinant Protein
  • IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein

Ref: AB-P6262
IFNG (Human) Recombinant Protein

Información del producto

Human IFNG (P01579) recombinant protein expressed in E.Coli.
Información adicional
Size 250 ug
Gene Name IFNG
Gene Alias IFG|IFI
Gene Description interferon, gamma
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
If a precipitate is observed, centrifuge the so
Application Key WB,Func
Immunogen Prot. Seq MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5.
Gene ID 3458

Enviar uma mensagem


IFNG (Human) Recombinant Protein

IFNG (Human) Recombinant Protein