OSM (Human) Recombinant Protein View larger

Human OSM (P13725) recombinant protein expressed in <i>E.Coli</i>.

AB-P6261

New product

OSM (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 11 pontos de fidelização. Seu carrinho totalizará 11 pontos de fidelização que podem ser convertidos num vale de desconto de 44.00EUR.


Data sheet

Size 100 ug
Gene Name OSM
Gene Alias MGC20461
Gene Description oncostatin M
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 5008

More info

Human OSM (P13725) recombinant protein expressed in E.Coli.

Enviar uma mensagem

Human OSM (P13725) recombinant protein expressed in <i>E.Coli</i>.

Human OSM (P13725) recombinant protein expressed in <i>E.Coli</i>.