NAMPT (Human) Recombinant Protein
  • NAMPT (Human) Recombinant Protein

NAMPT (Human) Recombinant Protein

Ref: AB-P6255
NAMPT (Human) Recombinant Protein

Información del producto

Human NAMPT (P43490) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name NAMPT
Gene Alias 1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN
Gene Description nicotinamide phosphoribosyltransferase
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile 20 mM HCl at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDS
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 10135

Enviar uma mensagem


NAMPT (Human) Recombinant Protein

NAMPT (Human) Recombinant Protein