CCL17 (Human) Recombinant Protein
  • CCL17 (Human) Recombinant Protein

CCL17 (Human) Recombinant Protein

Ref: AB-P6249
CCL17 (Human) Recombinant Protein

Información del producto

Human CCL17 (Q92583) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name CCL17
Gene Alias A-152E5.3|ABCD-2|MGC138271|MGC138273|SCYA17|TARC
Gene Description chemokine (C-C motif) ligand 17
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 6361

Enviar uma mensagem


CCL17 (Human) Recombinant Protein

CCL17 (Human) Recombinant Protein