View larger
Human THPO (P40225) recombinant protein expressed in CHO cells.
AB-P6244
New product
THPO (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 17 pontos de fidelização. Seu carrinho totalizará 17 pontos de fidelização que podem ser convertidos num vale de desconto de 68.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | THPO |
| Gene Alias | MGC163194|MGDF|MKCSF|ML|MPLLG|TPO |
| Gene Description | thrombopoietin |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func |
| Immunogen Prot. Seq | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 5 mM sodium phosphate, 140 mg L-Arginine, pH 7.5. |
| Gene ID | 7066 |
More info
Human THPO (P40225) recombinant protein expressed in CHO cells.