WISP2 (Human) Recombinant Protein
  • WISP2 (Human) Recombinant Protein

WISP2 (Human) Recombinant Protein

Ref: AB-P6229
WISP2 (Human) Recombinant Protein

Información del producto

Human WISP2 (O76076) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name WISP2
Gene Alias CCN5|CT58|CTGF-L
Gene Description WNT1 inducible signaling pathway protein 2
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile 10 mM acetic acid at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 8839

Enviar uma mensagem


WISP2 (Human) Recombinant Protein

WISP2 (Human) Recombinant Protein