DEFB103A (Human) Recombinant Protein
  • DEFB103A (Human) Recombinant Protein

DEFB103A (Human) Recombinant Protein

Ref: AB-P6225
DEFB103A (Human) Recombinant Protein

Información del producto

Human DEFB103A (P81534) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name DEFB103A
Gene Alias BD-3
Gene Description defensin, beta 103A
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile 10 mM acetic acid at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 414325

Enviar uma mensagem


DEFB103A (Human) Recombinant Protein

DEFB103A (Human) Recombinant Protein